PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_06068A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 320aa    MW: 33576.6 Da    PI: 7.467
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_06068AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd+ lv +v+++G+g+W++++   g+ R+ k+c++rw +yl
  Oropetium_20150105_06068A 14 KGPWTPEEDLMLVSYVQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
                               79********************************************97 PP

2Myb_DNA-binding51.32.7e-1667112148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Oropetium_20150105_06068A  67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                                89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.935965IPR017930Myb domain
SuperFamilySSF466892.02E-3011108IPR009057Homeodomain-like
SMARTSM007177.5E-141363IPR001005SANT/Myb domain
PfamPF002491.3E-161461IPR001005SANT/Myb domain
CDDcd001671.52E-111661No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129420.42766116IPR017930Myb domain
SMARTSM007174.3E-1666114IPR001005SANT/Myb domain
PfamPF002495.3E-1567112IPR001005SANT/Myb domain
CDDcd001672.14E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDLMLVSYVQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMQ  120
AGEGGGGEDG VGASEGAGAG AGGEVGGEKR PTVPKGQWER RLQTDIHTAR QALREALSLE  180
PSQPAKVAPV PTTPPSSSAT YASSAENIAR LLEGWLRPGK GPEASGSTST TGTTQQQRPQ  240
CSGEGGAASA SASHSGGAAA AAAQTPECST ETSKMASTAG AGAPPAFSML ESWLLDDGMG  300
HGEVGLIDVV PLGDPSEFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-26141164105C-Myb DNA-Binding Domain
1msf_C1e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519141e-171JF951914.1 Aegilops tauschii clone TaMYB31 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008652703.11e-169PREDICTED: myb-related protein 306-like
SwissprotP813921e-109MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A096QJ491e-169A0A096QJ49_MAIZE; Uncharacterized protein
STRINGGRMZM2G045748_P011e-169(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.14e-91myb domain protein 94